LiveBreach Intelligence: data breaches, leaks & ransomware, tracked as they surfaceOngoing protection: GalaxyWarden →
Recent BreachesData breach tracker

Recent Breaches › affinityhealthservices.net Listed by lockbit3 Ransomware Group

HIGH severityUnverified claimHow we verify

affinityhealthservices.net Listed by lockbit3 Ransomware Group: Ransomware Claim — What’s Alleged & What To Do

RBRecent Breaches Breach Intelligence·May 25, 2023
affinityhealthservices.net Listed by lockbit3 Ransomware Group

Reported May 25, 2023.

HIGH
Severity
May 25, 2023
Disclosed
ShareXLinkedInFacebookRedditWhatsAppTelegram

The affinityhealthservices.net Listed by lockbit3 Ransomware Group (reported May 25, 2023) is an unverified claim; the data involved is undisclosed belonging to roughly unknown people. If you have an account with them, your information may now be circulating on the open web and with data brokers. Here’s exactly what happened, how to check if you were affected, and what to do next.

Severity & verification
HIGH severityUnverified claim
Data types not itemised.
Published on a ransomware group’s leak site — an unverified extortion claim until the named organization or credible reporting corroborates it.
Check your exposure
See every leak and listing tied to your email. We can’t confirm any single incident against the sources we search, so we won’t pretend to. 15-second check, no card, no account. Details go to your inbox.

By running your scan you agree to the Terms and Conditions and the Privacy Policy, and to GalaxyWarden emailing you the results of this scan.

Ransomware groups continue to target healthcare and related service providers, treating internal networks as sources of leverage rather than mere endpoints. In that landscape, listings on criminal leak sites have become a routine signal that an organisation may have suffered intrusion, data theft, or both. On 25 May 2023, the domain affinityhealthservices.net appeared on a leak site operated by the LockBit3 ransomware group, accompanied by a claim that internal files had been taken.

Public detail remains limited. The number of people affected is unknown, and independent confirmation of the intrusion has not been widely published. What is recorded is the group’s assertion that roughly 110 GB of material, described as one part, was exfiltrated. For anyone connected to the organisation—patients, staff, or partners—the listing is a prompt to treat the possibility of exposure seriously until clearer facts emerge.

What happened

According to the available record, affinityhealthservices.net was listed by the LockBit3 ransomware group on 25 May 2023. The group claimed that internal files had been exfiltrated in a ransomware attack and summarised the material as “1 part : 110gb.” No further technical specifics—such as the initial access method, the precise date of intrusion, encryption of systems, or any ransom demand—have been disclosed in the facts at hand. The number of individuals whose information may be involved is listed as unknown. Because the primary source is a criminal leak-site posting, the episode should be understood as an unverified claim of compromise rather than a fully corroborated incident report.

Inside lockbit3

LockBit3 is a well-documented ransomware operation that has functioned as a ransomware-as-a-service platform. Affiliates gain access to victim networks, deploy the encryptor, and frequently steal data before encryption in a double-extortion model. The group maintains a Tor-based leak site where it names organisations, posts sample files or volume claims, and threatens public release if payment is not made. LockBit variants have been observed across many sectors, including healthcare and professional services, and the brand has been linked to high-volume campaigns over several years. Public reporting has described the use of common initial-access techniques such as compromised credentials, exploited vulnerabilities, and phishing, followed by lateral movement and data staging. None of these general tactics are confirmed for the affinityhealthservices.net listing; they simply describe how the group has operated elsewhere. Any statement that LockBit3 “exfiltrated” data from this particular organisation remains the group’s own claim unless corroborated by the victim or independent investigators.

Who is affinityhealthservices.net?

Affinityhealthservices.net presents as an organisation operating in the health-services sector. Entities of this type typically coordinate or deliver clinical, administrative, or support services and therefore handle sensitive personal and medical information as a routine part of operations. They may maintain electronic health records, billing and insurance data, employee files, and correspondence with patients or partner providers. A breach affecting such an organisation is consequential because the data involved is often long-lived and difficult to change—medical histories, identifiers, and contact details cannot be “reset” like a password. Even when the precise scope of an incident is unclear, the sector’s regulatory and ethical obligations mean that any credible claim of data theft warrants careful attention from both the organisation and the people it serves.

The information in question

The facts state only that internal files were exfiltrated in a ransomware attack and that the volume claimed was 110 GB in one part. No itemised list of data types—such as patient names, diagnoses, Social Security numbers, financial accounts, or employee records—has been disclosed. Organisations in health services commonly hold protected health information, demographic details, insurance identifiers, and internal operational documents. It is reasonable to expect that some mixture of those categories could be present in a large internal file set, yet it is not established what was actually taken. Readers should treat the exact contents as unconfirmed until the organisation or a competent authority provides a clearer inventory.

Why it matters

If internal files were copied, individuals connected to affinityhealthservices.net face practical risks that extend beyond the immediate incident. Stolen personal or medical data can be used for identity theft, targeted phishing, insurance fraud, or social-engineering attacks that reference real clinical or administrative details. Even partial records can help criminals craft convincing messages. For the organisation, a credible leak-site listing can trigger regulatory notification duties, contractual obligations to partners, and the operational cost of investigation and remediation. Uncertainty about scale does not remove the need for vigilance; unknown impact simply means that a wider circle of people may need to monitor their accounts and correspondence for unusual activity. The absence of a confirmed headcount or data inventory should not be read as evidence that no one was affected.

What to do if you're exposed

If you have a relationship with affinityhealthservices.net—as a patient, employee, or partner—begin by watching for official notices from the organisation itself; those remain the most reliable source of scope and recommended next steps. In parallel, place fraud alerts with major credit bureaus if you are in a jurisdiction where that is available, and review bank and insurance statements for unfamiliar activity. Be cautious of unsolicited messages that reference medical appointments, billing, or personal details, and verify any such contact through known official channels. Consider changing passwords on related accounts and enabling multi-factor authentication where it is offered. Finally, you can run a free exposure scan of your email address to check whether your information has already surfaced in known breach data sets; that step will not confirm or rule out involvement in this specific incident, but it can highlight other exposures that deserve attention.

AICompiled with AI assistance from public sources and published under our editorial standards.

Editorial & sourcing policy
Recent Breaches is a breach-monitoring service and news aggregator. We do not exfiltrate, host, purchase, or redistribute stolen data, and we do not hold the data claimed in leak-site listings. Incidents are compiled from publicly accessible sources and threat-intelligence platforms and are reported as claims attributed to their source. We promptly correct or remove material shown to be inaccurate — write to support@galaxywarden.com or press@recentbreaches.com.
Check if you’re exposed →

How this breach connects

Company

Attributed to

Method

Companyaffinityhealthservices.net security record
88/100
DoxxScan™ · Low doxx risk
B 83Good record

1 reported incident on record.

See affinityhealthservices.net’s full breach history →

More recent breaches

coastalplainsctr.org Listed by lockbit3 Ransomware GroupDecember 25, 2023olea.com Listed by lockbit3 Ransomware GroupDecember 24, 2023grandrapidswomenshealth.com Listed by lockbit3 Ransomware GroupDecember 14, 2023pcli.com Listed by lockbit3 Ransomware GroupDecember 14, 2023

Latest breaches

Read GalaxyWarden’s full analysis of the affinityhealthservices.net Listed by lockbit3 Ransomware Group →

Source: threat-actor leak-site listing

Publicly posted by lockbit — unverified claim, pending independent verification

Breach listings — particularly those originating from ransomware or leak sites — are third-party claims that may be unverified, incomplete, or inaccurate. A listing does not by itself confirm that a breach occurred or that any specific data was exposed. Severity is an automated assessment, not a definitive rating. Verification status is shown where available.

Attributions to threat groups and methods reflect public reporting and, in some cases, unverified claims made by the groups themselves; they may be incomplete or later revised. Recent Breaches and GalaxyWarden are independent and are not affiliated with, and do not endorse, any company or group named on this page. This information is aggregated from public sources for awareness only and is not legal, security, or investment advice.

ShareXLinkedInFacebookRedditWhatsAppTelegram